LOCUS NM_010015 638 bp mRNA linear ROD 24-AUG-2004
DEFINITION Mus musculus defender against cell death 1 (Dad1), mRNA.
ACCESSION NM_010015
VERSION NM_010015.1 GI:6753597
KEYWORDS .
SOURCE Mus musculus (house mouse)
ORGANISM Mus musculus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Rodentia; Sciurognathi; Muridae; Murinae; Mus.
REFERENCE 1 (bases 1 to 638)
AUTHORS Hong,N.A., Cado,D., Mitchell,J., Ortiz,B.D., Hsieh,S.N. and
Winoto,A.
TITLE A targeted mutation at the T-cell receptor alpha/delta locus
impairs T-cell development and reveals the presence of the nearby
antiapoptosis gene Dad1
JOURNAL Mol. Cell. Biol. 17 (4), 2151-2157 (1997)
PUBMED 9121464
REFERENCE 2 (bases 1 to 638)
AUTHORS Wang,K., Gan,L., Kuo,C.L. and Hood,L.
TITLE A highly conserved apoptotic suppressor gene is located near the
chicken T-cell receptor alpha chain constant region
JOURNAL Immunogenetics 46 (5), 376-382 (1997)
PUBMED 9271627
REFERENCE 3 (bases 1 to 638)
AUTHORS Apte,S.S., Mattei,M.G., Seldin,M.F. and Olsen,B.R.
TITLE The highly conserved defender against the death 1 (DAD1) gene maps
to human chromosome 14q11-q12 and mouse chromosome 14 and has plant
and nematode homologs
JOURNAL FEBS Lett. 363 (3), 304-306 (1995)
PUBMED 7737422
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. The reference sequence was derived from U83628.1.
FEATURES Location/Qualifiers
source 1..638
/organism="Mus musculus"
/mol_type="mRNA"
/db_xref="taxon:10090"
/chromosome="14"
/map="14 24.0 cM"
gene 1..638
/gene="Dad1"
/db_xref="GeneID:13135"
/db_xref="LocusID:13135"
/db_xref="MGI:101912"
CDS 31..372
/gene="Dad1"
/note="go_component: microsome [goid 0005792] [evidence
ISS] [pmid 12466851];
go_component: integral to membrane [goid 0016021]
[evidence TAS] [pmid 12466851];
go_component: oligosaccharyl transferase complex [goid
0008250] [evidence ISS] [pmid 12466851];
go_process: apoptosis [goid 0006915] [evidence ISS] [pmid
12466851];
go_process: anti-apoptosis [goid 0006916] [evidence ISS]
[pmid 12466851];
go_process: protein amino acid glycosylation [goid
0006486] [evidence ISS] [pmid 12466851]"
/codon_start=1
/product="defender against cell death 1"
/protein_id="NP_034145.1"
/db_xref="GI:6753598"
/db_xref="GeneID:13135"
/db_xref="LocusID:13135"
/db_xref="MGI:101912"
/translation="MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGY
CLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFAST
ILHLVVMNFVG"
ORIGIN
1 cgtccggtat ccgaagtccc cgtgttcgtc atgtcggcgt ctgtggtgtc cgtcatctcc
61 cggttcctgg aggagtactt gagctccact ccgcagcggc tgaagttgct ggacgcctat
121 ctcctttata tactgctgac cggggcgctg cagttcggct actgtctcct cgtgggcacc
181 ttccccttca actcgttcct ctctggcttc atctcttgtg tgggcagctt catcctagcg
241 gtttgcctga gaatacagat caacccccag aacaaggcgg acttccaagg catctctccg
301 gagcgagcct ttgctgactt cctctttgcc agcacgatcc tgcaccttgt cgtcatgaac
361 ttcgttggct gaactccgtt tccttactgt ggagttggag attggcggag cgctcactct
421 ttgacgtccc ctggatcagc attcttgagc tggcagcttg ttgcacatgg cttcttcaga
481 ttcgtgcttg actacgagtc tcactggttg tgaggtggca cgtccagaga actcccttcg
541 ctctatcgga ccaactccac agtgtacgtc tgttaacaca gaatctgcct cccctcactg
601 tagcccttac tttccatatt aaaaacattt cagcctcc